Protein Info for EX28DRAFT_1660 in Enterobacter asburiae PDN3

Annotation: putative efflux protein, MATE family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 49 to 68 (20 residues), see Phobius details amino acids 88 to 106 (19 residues), see Phobius details amino acids 125 to 143 (19 residues), see Phobius details amino acids 156 to 179 (24 residues), see Phobius details amino acids 185 to 208 (24 residues), see Phobius details amino acids 238 to 260 (23 residues), see Phobius details amino acids 273 to 297 (25 residues), see Phobius details amino acids 311 to 332 (22 residues), see Phobius details amino acids 346 to 363 (18 residues), see Phobius details amino acids 383 to 403 (21 residues), see Phobius details amino acids 415 to 434 (20 residues), see Phobius details TIGR00797: MATE efflux family protein" amino acids 13 to 418 (406 residues), 405.8 bits, see alignment E=9.1e-126 PF01554: MatE" amino acids 13 to 173 (161 residues), 142.1 bits, see alignment E=1.3e-45 amino acids 240 to 401 (162 residues), 129 bits, see alignment E=1.4e-41 PF14667: Polysacc_synt_C" amino acids 126 to 216 (91 residues), 32.9 bits, see alignment E=6.5e-12

Best Hits

Swiss-Prot: 93% identical to MDTK_ENT38: Multidrug resistance protein MdtK (mdtK) from Enterobacter sp. (strain 638)

KEGG orthology group: K03327, multidrug resistance protein, MATE family (inferred from 96% identity to enc:ECL_02346)

MetaCyc: 90% identical to multidrug efflux pump MdtK (Escherichia coli K-12 substr. MG1655)
RXN0-2561; TRANS-RXN-347; TRANS-RXN-348; TRANS-RXN-349

Predicted SEED Role

"Multi antimicrobial extrusion protein (Na(+)/drug antiporter), MATE family of MDR efflux pumps" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (453 amino acids)

>EX28DRAFT_1660 putative efflux protein, MATE family (Enterobacter asburiae PDN3)
MNEARQLLALAIPVIVAQVAQTAMGFVDTVMAGGYSATDMAAVAIGTSIWLPAILFGHGL
LLALTPVIAQLNGSGRRERIAHQVRQGFWLAGFVSVLIMVVLWNAGHIIRAMHNIDPALA
DKAVGYLRALLWGAPGYLFFQVARNQCEGLAKTKPGMVMGFIGLLVNIPVNYVFIYGHFG
MPELGGVGCGVATAAVYWVMFFSMIAFVKRARSMRDIRNEKRFSTPDWNIMTRLVQLGLP
IALALFFEVTLFAVVALLVSPLGIVNVAGHQIALNFSSLMFVLPMSLAAAVTIRVGFRLG
QGSTLDAQTAARTGLGVGVCMAVCTALFTVALREQIALLYNDNPEVVALASHLMLLAAIY
QISDSIQVIGSGVLRGYKDTRSIFFITFIAYWVLGLPAGYILALTDLVVDRMGPAGFWMG
FIIGLTSAAIMMMMRMRFLQRQPSTVILQRAAR