Protein Info for EX28DRAFT_1646 in Enterobacter asburiae PDN3

Annotation: Predicted membrane-associated, metal-dependent hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 541 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details transmembrane" amino acids 45 to 68 (24 residues), see Phobius details amino acids 75 to 95 (21 residues), see Phobius details amino acids 119 to 138 (20 residues), see Phobius details amino acids 150 to 172 (23 residues), see Phobius details PF08019: EptA_B_N" amino acids 56 to 203 (148 residues), 166 bits, see alignment E=5.9e-53 PF00884: Sulfatase" amino acids 235 to 524 (290 residues), 233.3 bits, see alignment E=4.2e-73

Best Hits

KEGG orthology group: K03760, phosphoethanolamine transferase (inferred from 93% identity to enc:ECL_02330)

Predicted SEED Role

"Phosphoethanolamine transferase EptA specific for the 1 phosphate group of core-lipid A" in subsystem Lipid A modifications

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (541 amino acids)

>EX28DRAFT_1646 Predicted membrane-associated, metal-dependent hydrolase (Enterobacter asburiae PDN3)
MWLIKKLQCNDIKFTLGCALFFTLLNGLFIQRSWAIIGPVHLHDFLFAASVPLVLFCGWV
IVFSLLNIPYLRKPLLIVLTIGCAAATYFMYTYGAVIDQNMIVNVFETNSQEATALVTPQ
MILWIVIAGLVPSVVLALTRIRTGKWWYALLTRVAAMLGALLVIILIAALFYKDYASLFR
NNKSIVKMVTPANYVSAVVKYSKMRWFAGDQTLVRIGEDAHKGSLIIGQQKKTVLVLVVG
EASRAANYSLNGYERETNPELKKQDVINFPQASSCGTETAVSVPCMFSGMTRSKYDADLA
HHREGLLDVLKHAGINLLWRDNDGGCKGACDRVPHTDMTQWQLDQFCKDKSCIDDVNFYR
LDNVLDGVKQDTVLVIHLMGSHGPAYYRRYPDNFRKFTPTCDTNEIQDCDHQALINTYDN
TILYTDSMVSKTIDALKARQSSMNTALIYLSDHGESLGESGIYLHGTPYMLAPEQQTHIP
FMFWLSPDYAKNFGINEQCLRDHAAKNAVSQDNLFSTVLGMMDVKSTVYQPQLDILSACR
P