Protein Info for EX28DRAFT_1641 in Enterobacter asburiae PDN3

Annotation: RND family efflux transporter, MFP subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details PF00529: CusB_dom_1" amino acids 32 to 295 (264 residues), 34.3 bits, see alignment E=4.7e-12 TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 53 to 242 (190 residues), 150.7 bits, see alignment E=2.3e-48 PF16576: HlyD_D23" amino acids 55 to 242 (188 residues), 62.9 bits, see alignment E=6.6e-21 PF13533: Biotin_lipoyl_2" amino acids 55 to 104 (50 residues), 63.4 bits, see alignment 3.1e-21 PF13437: HlyD_3" amino acids 165 to 245 (81 residues), 44.5 bits, see alignment E=5.9e-15

Best Hits

Swiss-Prot: 76% identical to YDHJ_ECOLI: Uncharacterized protein YdhJ (ydhJ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 94% identity to enc:ECL_02325)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (298 amino acids)

>EX28DRAFT_1641 RND family efflux transporter, MFP subunit (Enterobacter asburiae PDN3)
MPGPCRFDCVVNMSLKTLKYFSTLLVLALALVAGWWMWNFYMQSPWTRDGKVRAEQVSIT
PQVSGSITTLLVKDNQFVKKGDILFRIDDTPYHIAILNAQAQLAKAQSDLAKANNEANRR
RHLSQNYISAEDLDTANINVKAMQANVNVAEATLKQAQWQLTQTVITAPVDGWVTNLSAR
VGNYATTGQPIFALVDSHSFYVVGYFEETKLRHIREGSPAAITLYSGSQKLQGHVSSIGR
AIYDQSVETDSGLVPDIKPNVPWVRLAQRVPVRVEFDRLPQDIALVSGTTCTVSIGNR