Protein Info for EX28DRAFT_1638 in Enterobacter asburiae PDN3

Annotation: diguanylate cyclase (GGDEF) domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 43 to 65 (23 residues), see Phobius details amino acids 75 to 100 (26 residues), see Phobius details amino acids 116 to 137 (22 residues), see Phobius details amino acids 148 to 169 (22 residues), see Phobius details amino acids 189 to 213 (25 residues), see Phobius details amino acids 220 to 242 (23 residues), see Phobius details amino acids 253 to 273 (21 residues), see Phobius details PF17158: MASE4" amino acids 43 to 276 (234 residues), 209.5 bits, see alignment E=5.1e-66 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 289 to 452 (164 residues), 157.5 bits, see alignment E=1.3e-50 PF00990: GGDEF" amino acids 291 to 448 (158 residues), 165 bits, see alignment E=1.2e-52

Best Hits

KEGG orthology group: None (inferred from 60% identity to ent:Ent638_1806)

Predicted SEED Role

"FIG00626150: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (453 amino acids)

>EX28DRAFT_1638 diguanylate cyclase (GGDEF) domain (Enterobacter asburiae PDN3)
MYANHRSVKGRYISFCLGCIAVIGILHALFSKIAEWVPTFSSHLFPTLTIFLLVFDLFIA
CFMAMKYWCDRKRLYLVSLAFAFAGSASLMVGTLCSFPAWLDLYQFNAVNYNDAMIFYMF
RHLLMAVLIIVSAILYTTRNCPLSRLAHIAIVSGEFLFTVFAVGLAWMYSSHSSFLSIDL
VDNETREFMVLWSHFINIALIALWVVTLATLMFITRIRNLFWVGGNFLCVCYIVTLSMLL
VGGHVEDISWYRARLFETVATLMIIFVLLYDVFRLYRDSHVKYQQSYQNSIRDPLTRLYN
RSYFYETLKQALDIAKPSRPVSVIVSDLDRFKRINDTYGHLQGDKVLQFVANLLMDSVRP
QDIAARIGGEEFVLLLGNTSSDAAYQVAERIRLNLSSFDNSSSGGQLPEPITISMGVFTA
TSPAIAAETCVENADKAMYEAKETGRNRVVVFK