Protein Info for EX28DRAFT_1615 in Enterobacter asburiae PDN3

Annotation: transcriptional regulator, LacI family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF00356: LacI" amino acids 8 to 53 (46 residues), 62.7 bits, see alignment 4.6e-21 PF00532: Peripla_BP_1" amino acids 65 to 330 (266 residues), 268.6 bits, see alignment E=1.4e-83 PF13407: Peripla_BP_4" amino acids 67 to 280 (214 residues), 58.5 bits, see alignment E=1.6e-19 PF13377: Peripla_BP_3" amino acids 174 to 259 (86 residues), 32.9 bits, see alignment E=1.3e-11

Best Hits

Swiss-Prot: 74% identical to MALI_ECOLI: Maltose regulon regulatory protein MalI (malI) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 97% identity to enc:ECL_02277)

Predicted SEED Role

"Maltose regulon regulatory protein MalI (repressor for malXY)" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (342 amino acids)

>EX28DRAFT_1615 transcriptional regulator, LacI family (Enterobacter asburiae PDN3)
MAVAKKITINDVALAAGVSVSTVSLVLSGKGRISPATGQRVNEAVEQLGFVRNRQASALR
GGQSGVIGLIVRDLTSPFYAELTAGLTEALEAQGRMVFLLHGGREADQLLSRLDMLLNQG
VDGVIVAGASGVGSELCERAAEKGVPLVFASRASYLDEADTLRPDNMQAAQMLTEHLIRR
GHQRIAWLGGKSSSLTRAERVGGYCATLIKYGLPFHSEWVVECESSQKKAAEAIGALLRS
SPTISAVICYNDVIAMGAWFGLIRAGRQSGEGGVETFFGHQVALGAFADVGENALDDLPI
VWATTPAREMGYTLADRIMQRIDNTDVQAGHQIVAARLVTVK