Protein Info for EX28DRAFT_1592 in Enterobacter asburiae PDN3

Annotation: lipid A biosynthesis lauroyl (or palmitoleoyl) acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 transmembrane" amino acids 15 to 39 (25 residues), see Phobius details amino acids 79 to 97 (19 residues), see Phobius details amino acids 117 to 138 (22 residues), see Phobius details PF03279: Lip_A_acyltrans" amino acids 5 to 292 (288 residues), 318.6 bits, see alignment E=1.9e-99 TIGR02207: lipid A biosynthesis lauroyl (or palmitoleoyl) acyltransferase" amino acids 5 to 301 (297 residues), 426.2 bits, see alignment E=3.7e-132

Best Hits

Swiss-Prot: 68% identical to LPXP_SHIFL: Lipid A biosynthesis palmitoleoyltransferase (lpxP) from Shigella flexneri

KEGG orthology group: None (inferred from 88% identity to eae:EAE_20940)

MetaCyc: 68% identical to palmitoleoyl acyltransferase (Escherichia coli K-12 substr. MG1655)
PALMITOTRANS-RXN [EC: 2.3.1.242]

Predicted SEED Role

"Lipid A biosynthesis lauroyl acyltransferase (EC 2.3.1.-)" in subsystem KDO2-Lipid A biosynthesis (EC 2.3.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.242

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (302 amino acids)

>EX28DRAFT_1592 lipid A biosynthesis lauroyl (or palmitoleoyl) acyltransferase (Enterobacter asburiae PDN3)
MSQLFTYKLLHPRHWFSWAGLALLWVIVQLPYPVLYTLGSGLGKISRPFLKRRESIAVRN
IELCFPDMTPIARSQMINNNFVSLGLGLMETGMAWFWSDARVKKWFDVEGIENLANATGG
VMVVGIHFMSLELCGRVMGLCHPMMATYRPHNNPLMEWVQTKGRMRSNKAMIDRRNLSRL
VHALKAGEAVWFAPDQDYGPKGSVFAPFFSVKKAATTNGTYALSKLAGANLITLSMIRRS
DKKGYHMYISNPLLGYPEDDNIAAAAYMNKIIEREILRAPEQYLWMHRRFKTRPEGEDSL
YK