Protein Info for EX28DRAFT_1561 in Enterobacter asburiae PDN3

Annotation: lambda-like phage minor tail protein L

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 TIGR01600: phage minor tail protein L" amino acids 5 to 247 (243 residues), 187.2 bits, see alignment E=1.2e-59 PF05100: Phage_tail_L" amino acids 24 to 248 (225 residues), 267.5 bits, see alignment E=3.1e-84

Best Hits

Swiss-Prot: 76% identical to TIPL_BPN15: Tail tip protein L (gene) from Escherichia phage N15

KEGG orthology group: None (inferred from 76% identity to ent:Ent638_2223)

Predicted SEED Role

"Phage minor tail protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (251 amino acids)

>EX28DRAFT_1561 lambda-like phage minor tail protein L (Enterobacter asburiae PDN3)
MITEDYQRLEPGEKIRLLEVDGSAFGLDDVLRFHAYNLPHTAEEIAAAGGEESKLKAKSI
WWQGEEYGAWPYKLEGLEASTDGSSAQPTLTVANIDSSITALCLAYDDMLQAKVTIHDTF
AHYLDARNFSDGNPTADPLQVRKRVFYIDGKNSELPGESIEFVLTSPMDLQGLMIPTRQL
HSLCTWCIRNRYRTGDGCDYAGTLYFDRNNNPVSDPSLDECNGTLTACKLRFGEHNELPF
GGFPGTSLIRS