Protein Info for EX28DRAFT_1554 in Enterobacter asburiae PDN3

Annotation: Peptidase S24-like

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00717: Peptidase_S24
  • amino acids 16 to 131 (116 residues), 106.6 bits, E=3.2e-35

Best Hits

Swiss-Prot: 87% identical to UMUD_SALTY: Protein UmuD (umuD) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03503, DNA polymerase V [EC: 3.4.21.-] (inferred from 91% identity to ent:Ent638_2213)

MetaCyc: 80% identical to DNA polymerase V protein UmuD (Escherichia coli K-12 substr. MG1655)
DNA-directed DNA polymerase. [EC: 2.7.7.7]

Predicted SEED Role

"Error-prone repair protein UmuD"

KEGG Metabolic Maps

• Purine metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7, 3.4.21.-

Use Curated BLAST to search for 2.7.7.7 or 3.4.21.-

Protein Sequence (139 amino acids)

>EX28DRAFT_1554 Peptidase S24-like (Enterobacter asburiae PDN3)
MEFIRPTELREIIALPLFSDLVQCGFPSPAADYVEQRIDLNELLVTHPSSTYFVKAAGDS
MIEAGISDGDLLVVDSSRTAEHGDIVIAAVEGEFTVKRLQLRPTVQLIPMNSAYSPIVVG
SEDTLDVFGVVTFIVKSAS