Protein Info for EX28DRAFT_1546 in Enterobacter asburiae PDN3

Annotation: transporter, basic amino acid/polyamine antiporter (APA) family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 39 to 61 (23 residues), see Phobius details amino acids 82 to 110 (29 residues), see Phobius details amino acids 127 to 146 (20 residues), see Phobius details amino acids 157 to 178 (22 residues), see Phobius details amino acids 203 to 222 (20 residues), see Phobius details amino acids 234 to 257 (24 residues), see Phobius details amino acids 283 to 311 (29 residues), see Phobius details amino acids 332 to 351 (20 residues), see Phobius details amino acids 358 to 378 (21 residues), see Phobius details amino acids 385 to 402 (18 residues), see Phobius details amino acids 408 to 426 (19 residues), see Phobius details amino acids 441 to 459 (19 residues), see Phobius details TIGR00905: transporter, basic amino acid/polyamine antiporter (APA) family" amino acids 3 to 459 (457 residues), 593.8 bits, see alignment E=1.3e-182 PF13520: AA_permease_2" amino acids 5 to 416 (412 residues), 274.2 bits, see alignment E=2e-85 PF00324: AA_permease" amino acids 14 to 418 (405 residues), 51.2 bits, see alignment E=8.7e-18

Best Hits

Swiss-Prot: 89% identical to ARCD_ECOLI: Putative arginine/ornithine antiporter (ydgI) from Escherichia coli (strain K12)

KEGG orthology group: K03758, arginine:ornithine antiporter (inferred from 97% identity to enc:ECL_02266)

Predicted SEED Role

"Arginine/ornithine antiporter ArcD" in subsystem Arginine Deiminase Pathway or Arginine and Ornithine Degradation or Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (460 amino acids)

>EX28DRAFT_1546 transporter, basic amino acid/polyamine antiporter (APA) family (Enterobacter asburiae PDN3)
MEKKLGLSALTALVLSSMLGAGVFSLPQNMAAVASPSALIIGWGITGVGILLLAFAMLLL
TRIRPDLDGGIFTYAREGFGELIGFCSAWGYWLCAVIANVSYLVIVFSALSFFTDTPELR
LFGDGNTWQSIVGASVLLWFVHWLVLRGVQTAASINLVATLAKLVPLGLFIVLAFIAFRM
DVFKLDFSGVALGVPVWEQVKNTMLITLWVFIGVEGAVVVSARARNKRDVGRATLLAVLA
ALGVYLLVTLLSLGVVARPELAEMRNPSMAGLMVKMLGPWGDVVIAAGLIVSVCGAYLSW
TIMAAEVPFLAATHKAFPRLFARQNQNSAPSASLWLTNISVQVCLVLIWLTGSDYNTLLT
IASEMILVPYFLVGAYLLKIATRPAHYVVGVGACIYGLWLLYASGPMHLLLSVVLYAPGL
LVFIYARRTHQLENALKRREMALIGLLLVAALPATWMLMG