Protein Info for EX28DRAFT_1540 in Enterobacter asburiae PDN3

Annotation: cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 PF00027: cNMP_binding" amino acids 51 to 132 (82 residues), 61.9 bits, see alignment E=6.9e-21 PF13545: HTH_Crp_2" amino acids 168 to 240 (73 residues), 60.2 bits, see alignment E=2.4e-20 PF00325: Crp" amino acids 193 to 224 (32 residues), 58.8 bits, see alignment 5.1e-20

Best Hits

Swiss-Prot: 98% identical to FNR_SALMS: Fumarate and nitrate reduction regulatory protein (fnr) from Salmonella muenster

KEGG orthology group: K01420, CRP/FNR family transcriptional regulator, anaerobic regulatory protein (inferred from 99% identity to ent:Ent638_1853)

Predicted SEED Role

"Fumarate and nitrate reduction regulatory protein" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (250 amino acids)

>EX28DRAFT_1540 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases (Enterobacter asburiae PDN3)
MIPEKRIIRRIQSGGCAIHCQDCSISQLCIPFTLNEHELDQLDNIIERKKPIQKGQTLFK
AGDELKSLYAIRSGTIKSYTITEQGDEQITGFHLAGDLVGFDAIGTGHHPSFAQALETSM
VCEIPFETLDDLSGKMPNLRQQMMRLMSGEIKGDQDMILLLSKKNAEERLAAFIYNLSRR
FAERGFSPREFRLTMTRGDIGNYLGLTVETISRLLGRFQKSGMLAVKGKYITIENGEALA
VLAGHARNVA