Protein Info for EX28DRAFT_1532 in Enterobacter asburiae PDN3

Annotation: methyl-accepting chemotaxis sensory transducer with TarH sensor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 553 transmembrane" amino acids 6 to 32 (27 residues), see Phobius details amino acids 194 to 214 (21 residues), see Phobius details PF02203: TarH" amino acids 1 to 174 (174 residues), 123.2 bits, see alignment E=1.8e-39 PF00672: HAMP" amino acids 216 to 264 (49 residues), 50.2 bits, see alignment 4.1e-17 PF00015: MCPsignal" amino acids 329 to 484 (156 residues), 201.7 bits, see alignment E=1.2e-63

Best Hits

Swiss-Prot: 67% identical to MCPC_SALTY: Methyl-accepting chemotaxis citrate transducer (tcp) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 94% identity to enc:ECL_02252)

Predicted SEED Role

"Methyl-accepting chemotaxis protein I (serine chemoreceptor protein)" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (553 amino acids)

>EX28DRAFT_1532 methyl-accepting chemotaxis sensory transducer with TarH sensor (Enterobacter asburiae PDN3)
MLKNLHVITGIIFALTIFCLLQVVTGGLFYSAVSNDRHNFQNSGVLNAQQESLSDSVNTL
VKTRVTVTRVAIRYLKNQRDPASLAAINKLLGTAADSLAKAEAFNKEWQKLPQVNGQEAA
LTDEMQKSWNQMHEVMRLSIEYLRADNYQAYGDLDAQQAQDEMEAVYNRWRAENNTLLKA
ATEENQSSFTQMQWTLVAILLAVIAVLVVIWQGLQHLLLKPLHSIMNHIRAIAGGDLTQE
IAISGRNEMGQLAAGLHEMQQSLVTTVSAVRGSTDSIYTGAGEIAAGSNDLSARTEQQAA
SLEETAASMEELTATVKQNSDNARQATLLAKNASETAARGGHVVDNVVRTMNEIADSSQQ
IAHITGVIDSIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRTLASRSAQAAKEIKGL
IENSVSRVNTGSEQVSEAGTTMKEIVAAVTRVTDIMGEISSASDEQSRGIEQVSLAVSQM
DSVTQQNAALVQESATAAAALEDQSEQLRQAVAAFRLNGKEKAVAPRPASLKTPQLLRPA
TTTASTDSNWETF