Protein Info for EX28DRAFT_1528 in Enterobacter asburiae PDN3

Annotation: Nucleotidyltransferase/DNA polymerase involved in DNA repair

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 PF00817: IMS" amino acids 5 to 150 (146 residues), 138.6 bits, see alignment E=3.2e-44 PF11798: IMS_HHH" amino acids 169 to 199 (31 residues), 29 bits, see alignment (E = 1.7e-10) PF11799: IMS_C" amino acids 243 to 359 (117 residues), 90.8 bits, see alignment E=1.5e-29 PF13438: DUF4113" amino acids 371 to 419 (49 residues), 71.7 bits, see alignment 8.2e-24

Best Hits

Swiss-Prot: 70% identical to UMUC_SALTY: Protein UmuC (umuC) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03502, DNA polymerase V (inferred from 80% identity to eam:EAMY_2106)

MetaCyc: 66% identical to DNA polymerase V catalytic protein (Escherichia coli K-12 substr. MG1655)
DNA-directed DNA polymerase. [EC: 2.7.7.7]

Predicted SEED Role

"Error-prone, lesion bypass DNA polymerase V (UmuC)"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (420 amino acids)

>EX28DRAFT_1528 Nucleotidyltransferase/DNA polymerase involved in DNA repair (Enterobacter asburiae PDN3)
MFALVDVNSFYASCEKVFRPDLEGKPIVVVSNNDGCIISLSREAKQFGIKMGEPYFKFKE
KLYPSKVYVFSSNYALYADLSSRVMQTLTDLAPAIEIYSIDEAFVNVSGVSHCLSLEAFG
HQMRTQVFKNTGLTVGVGIAPTKTLAKLANYAAKRWASTGGVVDLSGRERQRKLLAKVPV
EEVWGVGRRITKKLNAMGITTALELAEASSWVIRKHFNVVMERTARELRSEPCLDLEEFT
PTKQQIICSRSFGHRITQYEEMHQAICAYAERAAEKLRGEHQYCRFISVFVRTSPHADNE
IYYGNQASVTLMTPTNDSRDIIRAATEALGRIWLDGYRYMKAGVMLADFFSSGVAQLNLF
DDNRLRANSAALMEMMDSVNHSGKGKIWFAGQGIEKSWAMKREMLSPAYTTRYADLPVAK