Protein Info for EX28DRAFT_1524 in Enterobacter asburiae PDN3

Annotation: Dioxygenases related to 2-nitropropane dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 PF03060: NMO" amino acids 5 to 325 (321 residues), 187.3 bits, see alignment E=7.4e-59 PF01070: FMN_dh" amino acids 141 to 220 (80 residues), 26.2 bits, see alignment E=6.2e-10

Best Hits

KEGG orthology group: K02371, enoyl-[acyl carrier protein] reductase II [EC: 1.3.1.-] (inferred from 87% identity to seh:SeHA_C1729)

Predicted SEED Role

"putative dehydrogenase"

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (326 amino acids)

>EX28DRAFT_1524 Dioxygenases related to 2-nitropropane dioxygenase (Enterobacter asburiae PDN3)
MKNNRICQILGIEKPVIQGPLSWLTDARLVAAVSNAGGLGVLGPNAGLTADTAVSTPEET
AEKMREEIRKTKRLTEKPFGVNLIPTAVNDVWTGPILQVVKDEGVRVVVYTGYGEGSIIP
ALFSELREAGIAVIYRDINPTPENTRLAEEMGADIIVATGFDEGGTLPATALGTFSIVPL
IADAVKHIPVMAAGGITDNRTARAAHALGAEGVFAGSVFISTEESRVPQSVKEKIVAANG
LDLLLFRTVPHYYRSLPGKLAEKLAAMDKAGASNEALGKAMGGLRGLRLGMLEGNTDEGY
IALGTGIGNIRSVKSVAEVVNALTVE