Protein Info for EX28DRAFT_1506 in Enterobacter asburiae PDN3

Annotation: Acid shock protein repeat

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF06392: Asr" amino acids 22 to 114 (93 residues), 50.9 bits, see alignment E=1e-17 amino acids 60 to 154 (95 residues), 62.8 bits, see alignment E=2e-21

Best Hits

Swiss-Prot: 69% identical to ASR_KLEPN: Acid shock protein (asr) from Klebsiella pneumoniae

KEGG orthology group: None (inferred from 69% identity to kpe:KPK_2345)

Predicted SEED Role

"Acid shock protein 2 precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (154 amino acids)

>EX28DRAFT_1506 Acid shock protein repeat (Enterobacter asburiae PDN3)
MNKVLALVVAAAMGLSSAAFAADTTATAAPAAAPAATTTAAPAKAVHHKKHHKAAAKKEA
AAPATAAPTEQKAQAAKKHHKKAAKPAVEQKAQAAKKHHKKATKPAVEQKAQAAKKHHKK
ATKPAVEQKAQAAKKHHKKAVKHEAAKPAAQPAA