Protein Info for EX28DRAFT_1473 in Enterobacter asburiae PDN3

Annotation: RND family efflux transporter, MFP subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 signal peptide" amino acids 1 to 45 (45 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 42 to 378 (337 residues), 279.5 bits, see alignment E=1.6e-87 PF13533: Biotin_lipoyl_2" amino acids 66 to 115 (50 residues), 62.2 bits, see alignment 4.6e-21 PF16576: HlyD_D23" amino acids 67 to 297 (231 residues), 63.3 bits, see alignment E=3.1e-21 PF13437: HlyD_3" amino acids 177 to 294 (118 residues), 27.4 bits, see alignment E=6.9e-10

Best Hits

KEGG orthology group: None (inferred from 96% identity to ent:Ent638_1891)

Predicted SEED Role

"RND efflux system, membrane fusion protein CmeA" in subsystem Multidrug Resistance Efflux Pumps or Multidrug efflux pump in Campylobacter jejuni (CmeABC operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (391 amino acids)

>EX28DRAFT_1473 RND family efflux transporter, MFP subunit (Enterobacter asburiae PDN3)
MSLQKTWGNFHLNALGAILLSVLLVGCDNSVAQNAAPPAPAVSAADVVVKSISQWDRFNG
RIEAVESVQLRPRVSGYIDKVNYTDGQEVKKGEVLFTIDDRTYRAALEQAQANLARAKTQ
ASLAQSEANRTDKLVNTNVVSREEWEQRRSAATQAQADIRAAQAAVDAAQLNLDFTKVTA
PIDGRASRALITSGNLVTAGDTASVLTTLVSQKTVYVYFDVDESTYLHYQNLARSGQGAS
SNHTALPVEIGLTGEEGYPHQGKVDFLDNQLTPSTGTIRMRALLDNAQRQFTPGLFARVR
LPGSAEFKATLIDDKAVLTDQDRKYVYIVDKEGKAQRRDITPGRLADGLRIVRQGLNPGD
KVIVEGLQKVFMPGMPVNAKTVAMTATSALN