Protein Info for EX28DRAFT_1470 in Enterobacter asburiae PDN3

Annotation: Signal transduction histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 transmembrane" amino acids 17 to 38 (22 residues), see Phobius details amino acids 168 to 188 (21 residues), see Phobius details PF00512: HisKA" amino acids 244 to 304 (61 residues), 55 bits, see alignment E=6.9e-19 PF02518: HATPase_c" amino acids 352 to 458 (107 residues), 88 bits, see alignment E=6.1e-29

Best Hits

KEGG orthology group: None (inferred from 84% identity to ctu:CTU_28580)

Predicted SEED Role

"integral membrane sensor signal transduction histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (462 amino acids)

>EX28DRAFT_1470 Signal transduction histidine kinase (Enterobacter asburiae PDN3)
MRNVWYHLRRPTLVRRIIIAQMLLLTLLWCLFVTFILWEDLRSPPIITGSNTYETLFTLV
ERMDGRPQDRTAVLEAFSKALREGYGGGEDPVLSINLIVRKNNAVIFSSEGAPAGVINTR
LGEMEHVQSEGRVWTSRTLKSAHSDVEVTLFTPASGWNFFIYLNSRGYYILPLLVCFPFL
LFPAWLSIRIAMRPWNKVVNEITLRAPDDLSPLKAVPGHRELRQMVDAINDFLARVRESA
ERERVFIADAAHELRTPLAAMRINVEALQSWVISESQQELLAGVIRSNSRAARLVNQLLL
MMHSEARIDTEMEPVPLTTLIQERMAELEPLASARRIELEFFAEDDIWIAGVRERLVSLI
DNLIENAVKYNPEGGRIQVDVCTSDDFARLRVSDAGPGIPVELRERVFDRFFRDPNQVQS
GSGLGLAIVKAVAQQHNSSVNLSTSAEGGLMVTVDFPNRTFS