Protein Info for EX28DRAFT_1464 in Enterobacter asburiae PDN3

Annotation: Uncharacterized component of anaerobic dehydrogenases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 PF02613: Nitrate_red_del" amino acids 50 to 163 (114 residues), 81.4 bits, see alignment E=3.2e-27

Best Hits

Swiss-Prot: 74% identical to DMSD_SALPA: Tat proofreading chaperone DmsD (dmsD) from Salmonella paratyphi A (strain ATCC 9150 / SARB42)

KEGG orthology group: None (inferred from 85% identity to enc:ECL_02192)

Predicted SEED Role

"Putative oxidoreductase component of anaerobic dehydrogenases; Functional role page for Chaperone protein TorD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (204 amino acids)

>EX28DRAFT_1464 Uncharacterized component of anaerobic dehydrogenases (Enterobacter asburiae PDN3)
MKDVSHSESFAFSARVLGALFYFAPDSEQAAPLVKALTAGEWVQDWPLPAETLQPVADTF
ASSSDEPLADAWQRLFIGPYALPAPPWGSVWLDRESVLFGDSTLALRQWMRENNIAFEMQ
QNEPEDHFGTLLLLAAWLAENGREAECEQLLAWHLLPWSTRFLSVFVDNAGHPFYAALGR
LAQLTLADWRSGLLIPVAEKTLYR