Protein Info for EX28DRAFT_1455 in Enterobacter asburiae PDN3

Annotation: Sugar phosphate permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 53 to 77 (25 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details amino acids 113 to 134 (22 residues), see Phobius details amino acids 155 to 180 (26 residues), see Phobius details amino acids 187 to 208 (22 residues), see Phobius details amino acids 244 to 269 (26 residues), see Phobius details amino acids 281 to 299 (19 residues), see Phobius details amino acids 307 to 327 (21 residues), see Phobius details amino acids 334 to 355 (22 residues), see Phobius details amino acids 376 to 395 (20 residues), see Phobius details amino acids 401 to 422 (22 residues), see Phobius details PF07690: MFS_1" amino acids 21 to 368 (348 residues), 104.7 bits, see alignment E=5.2e-34 amino acids 282 to 440 (159 residues), 35.4 bits, see alignment E=6e-13 PF00083: Sugar_tr" amino acids 62 to 219 (158 residues), 71.6 bits, see alignment E=6.4e-24 amino acids 226 to 432 (207 residues), 22.3 bits, see alignment E=5.7e-09

Best Hits

Swiss-Prot: 85% identical to YDFJ_ECOLI: Putative transporter YdfJ (ydfJ) from Escherichia coli (strain K12)

KEGG orthology group: K08173, MFS transporter, MHS family, metabolite:H+ symporter (inferred from 92% identity to ent:Ent638_1934)

Predicted SEED Role

"Putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (455 amino acids)

>EX28DRAFT_1455 Sugar phosphate permease (Enterobacter asburiae PDN3)
MTQAQPQRTTSDLVKAAVSGWLGTALEFMDFQLYSLGAALVFHEIFFPEQSAAMALILAM
GTYGAGYIARIVGAFIFGRMGDSIGRKKVLFITITMMGICTTLIGVLPTYAQIGIFAPVL
LVTLRIIQGLGAGAEISGAGTMLAEYAPKGKRGIISSLVAMGTNCGTLSATAIWAVMFFA
LDREELIAWGWRVPFLASVVVMIFAIWLRMNLKESPVFEKVNDAQTAQPDTSLGSMVKSK
SFWLATGLRFGQAGNSGLIQTFLAGYLVQTLLFDKAIPTDALMISSILGFISIPLLGWLS
DKVGRRLPYIILNISAILLAYPMLSIIVDKSYAPGTIMLSIIVIHNFAVLGLFALENITM
AEMFGSRNRFTRMAISKEAGGLVAVGFGPVLAGIFCNMTGSWWPIVAMLVAYSVIGLASA
ILMPEVRDRDLSAAQDAAESAPEERVGYGAISSRR