Protein Info for EX28DRAFT_1436 in Enterobacter asburiae PDN3

Annotation: Major Facilitator Superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 41 to 62 (22 residues), see Phobius details amino acids 72 to 89 (18 residues), see Phobius details amino acids 97 to 121 (25 residues), see Phobius details amino acids 136 to 156 (21 residues), see Phobius details amino acids 161 to 179 (19 residues), see Phobius details amino acids 211 to 233 (23 residues), see Phobius details amino acids 248 to 269 (22 residues), see Phobius details amino acids 277 to 297 (21 residues), see Phobius details amino acids 309 to 330 (22 residues), see Phobius details amino acids 342 to 361 (20 residues), see Phobius details amino acids 367 to 388 (22 residues), see Phobius details PF07690: MFS_1" amino acids 9 to 335 (327 residues), 79.9 bits, see alignment E=1.8e-26 PF12832: MFS_1_like" amino acids 21 to 372 (352 residues), 49.7 bits, see alignment E=3e-17

Best Hits

KEGG orthology group: None (inferred from 89% identity to enc:ECL_02166)

Predicted SEED Role

"MFS transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (402 amino acids)

>EX28DRAFT_1436 Major Facilitator Superfamily (Enterobacter asburiae PDN3)
MSLRSLRALCLTSFFIADVRDGLGPFLGIFLTERHWTPDDIGILMTAGGLAGLLATLPAG
FITDTSRSKRTVLALVCLLITLSTLLLWFSQQSAVVAVSQIVSGICAAFVGPLIAGITLG
LTGQGGFSAQMGKNEAFNHGGNFVTALIAGGIAWYWGVGGIFLLMTCTTLLTLCALLAIR
NGDIDNDAARGLSSSTSLPVPGFAMLIKNRALFVTGLTLLLFHLANAALLPMLSMRVAAA
PASINPGLYAAGTVIISQAVMIPVAIWVANRIDRYGYWRLIMLALLVMPVRAALAASTDA
PLMMIPVQILDGLAAGILGVVVPSFIVVLLRGSGHVNAGQSVVMLMQGVGASMSPALTGT
IAGHYSFATAFSVLSAIALVAVLLWWCFAHRTWETDSTPGGA