Protein Info for EX28DRAFT_1424 in Enterobacter asburiae PDN3

Annotation: diguanylate cyclase (GGDEF) domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 transmembrane" amino acids 21 to 45 (25 residues), see Phobius details amino acids 65 to 85 (21 residues), see Phobius details amino acids 92 to 112 (21 residues), see Phobius details amino acids 118 to 136 (19 residues), see Phobius details amino acids 141 to 159 (19 residues), see Phobius details amino acids 165 to 188 (24 residues), see Phobius details PF17178: MASE5" amino acids 28 to 209 (182 residues), 137.6 bits, see alignment E=4.9e-44 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 207 to 366 (160 residues), 157.2 bits, see alignment E=1.6e-50 PF00990: GGDEF" amino acids 210 to 365 (156 residues), 159.5 bits, see alignment E=6e-51

Best Hits

KEGG orthology group: None (inferred from 83% identity to enc:ECL_02159)

Predicted SEED Role

"Two-component response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (368 amino acids)

>EX28DRAFT_1424 diguanylate cyclase (GGDEF) domain (Enterobacter asburiae PDN3)
MEKRKKPTLERATWPTRHAMVMHGLAMNLPWLAFVNISFAVMILLRHVLLNTSDPLYPHS
PQLTRIVDASMLGIIILSAALILMAWRRIAGISVVLFICSAIWSVSCFWFITQLLLPHVW
PLCVILLLAGLTALYFYPEGLLAFVLPLWITLPVASWIRNDGLNLHFFVIWSVFTLILIC
GRFILLSWFDEAWRRNQQNQLLISRLDALAHQDPLTKTANRRKMEVVLENAVEQKKIFSV
IMLDIDYFKRYNDTYGHQAGDDCLTRVARVLKQSVRTPDDVVSRYGGEEFVVILFNCPEN
IAEKVALRIQDGLRAESIPHSASTVSDHVTASMGIASMTEGLAGTEIIARADAALYRAKE
AGRDRVCR