Protein Info for EX28DRAFT_1395 in Enterobacter asburiae PDN3

Annotation: Putative NADPH-quinone reductase (modulator of drug activity B)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02525: Flavodoxin_2
  • amino acids 9 to 191 (183 residues), 149.5 bits, E=1e-47
• PF03358: FMN_red
  • amino acids 11 to 142 (132 residues), 54.8 bits, E=8.6e-19

Best Hits

Swiss-Prot: 32% identical to Y1544_HAEIN: Uncharacterized NAD(P)H oxidoreductase HI_1544 (HI_1544) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K00355, NAD(P)H dehydrogenase (quinone) [EC: 1.6.5.2] (inferred from 83% identity to enc:ECL_02110)

Predicted SEED Role

"NAD(P)H oxidoreductase YRKL (EC 1.6.99.-) @ Putative NADPH-quinone reductase (modulator of drug activity B) @ Flavodoxin 2" (EC 1.6.99.-)

MetaCyc Pathways

• superpathway of photosynthetic hydrogen production (3/6 steps found)
• vitamin K-epoxide cycle (1/4 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.2

Use Curated BLAST to search for 1.6.5.2 or 1.6.99.-

Protein Sequence (199 amino acids)

>EX28DRAFT_1395 Putative NADPH-quinone reductase (modulator of drug activity B) (Enterobacter asburiae PDN3)
MSATNAINNALIVTAHPVDNSLSHSLAAHIAGRLREQGTQVEIADLHAEGFNPAMTRADL
DLYHGDPSALPDDILHEQQRVERADMLVFVFPVYWWSVPALLKGWFDRVLTLNWAYKVAD
DGRIVGSLRDVPVRLIATGGSDLTGFDKHGYSTAIQTQIIEGVFGFCGLKNVKLDILYQA
DTATPEQVEEFLKGLEGLK