Protein Info for EX28DRAFT_1370 in Enterobacter asburiae PDN3

Annotation: Protein of unknown function (DUF2878)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 161 transmembrane" amino acids 7 to 24 (18 residues), see Phobius details amino acids 30 to 47 (18 residues), see Phobius details amino acids 54 to 73 (20 residues), see Phobius details amino acids 79 to 97 (19 residues), see Phobius details amino acids 104 to 123 (20 residues), see Phobius details amino acids 135 to 156 (22 residues), see Phobius details PF11086: DUF2878" amino acids 10 to 151 (142 residues), 89.7 bits, see alignment E=1.2e-29

Best Hits

KEGG orthology group: None (inferred from 83% identity to enc:ECL_02101)

Predicted SEED Role

"FIG147341: Hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (161 amino acids)

>EX28DRAFT_1370 Protein of unknown function (DUF2878) (Enterobacter asburiae PDN3)
MRRYLQVFLLAVAFDLYWALVVLFREQGLIIWLALAILACLLLPPAYRFYAIGLAAAGSL
LDALWALTGLIAFMGESLMPLWMVALWLMFATVWTQLTRTTTLPGWLLTLLAAVGGPVAY
LFGERLGGITFLEPTFIVVGWMAPGWLVLMLFFHLLMGRQK