Protein Info for EX28DRAFT_1352 in Enterobacter asburiae PDN3

Annotation: Arabinose efflux permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 439 transmembrane" amino acids 18 to 43 (26 residues), see Phobius details amino acids 54 to 79 (26 residues), see Phobius details amino acids 91 to 110 (20 residues), see Phobius details amino acids 117 to 143 (27 residues), see Phobius details amino acids 156 to 180 (25 residues), see Phobius details amino acids 189 to 208 (20 residues), see Phobius details amino acids 243 to 267 (25 residues), see Phobius details amino acids 280 to 300 (21 residues), see Phobius details amino acids 309 to 328 (20 residues), see Phobius details amino acids 334 to 358 (25 residues), see Phobius details amino acids 373 to 395 (23 residues), see Phobius details amino acids 404 to 423 (20 residues), see Phobius details PF00083: Sugar_tr" amino acids 17 to 232 (216 residues), 95.7 bits, see alignment E=4.5e-31 PF07690: MFS_1" amino acids 30 to 383 (354 residues), 100.5 bits, see alignment E=1.4e-32 amino acids 257 to 423 (167 residues), 39.8 bits, see alignment E=4.3e-14 PF13347: MFS_2" amino acids 161 to 367 (207 residues), 37.4 bits, see alignment E=1.8e-13

Best Hits

KEGG orthology group: None (inferred from 92% identity to cro:ROD_16251)

Predicted SEED Role

"putative integral membrane transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (439 amino acids)

>EX28DRAFT_1352 Arabinose efflux permease (Enterobacter asburiae PDN3)
MTEHESTTTVLRKNKKVLIASLTGSAIEWFDYFLYGTAAALVFNKIFFPMVDPVIGLILS
YLSFSLTFFIRPIGGVLFAHIGDRIGRKKTLVLTLSLMGGATVMIGLLPTYEMIGLWAPA
LLILMRIIQGMGIGGEWGGALLLAYEYAPEKRKGFFGSIPQAGVTIGMLMATFIVSLMTL
FSEEDFLSWGWRIPFLLSSILVLLGLWIRKDIDETPDFKKVKQSGQVAKAPLRDTLKHHW
REVLIAAGLKVVETAPFYIFSTFVVSYATTTLTYQKSQALEAVTLGALVATVMIPLMGLL
SDKIGRQRMYAASVIILGLFIVPWFMLLNTGTTWGIVLATVIAFGVLWAPVTAVLGTLCS
EIFSANVRYTGITLGYQLGAALAGGTAPLIATGLLAKYDGDWVPVAWYLAVTVAISLIAI
FCASRVKRASLLQAQPEHL