Protein Info for EX28DRAFT_1346 in Enterobacter asburiae PDN3

Annotation: type I secretion outer membrane protein, TolC family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details TIGR01844: type I secretion outer membrane protein, TolC family" amino acids 40 to 438 (399 residues), 316.5 bits, see alignment E=1.4e-98 PF02321: OEP" amino acids 50 to 227 (178 residues), 80.7 bits, see alignment E=5.8e-27 amino acids 256 to 412 (157 residues), 55.6 bits, see alignment E=3.1e-19

Best Hits

KEGG orthology group: None (inferred from 90% identity to enc:ECL_02077)

Predicted SEED Role

"Agglutination protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (445 amino acids)

>EX28DRAFT_1346 type I secretion outer membrane protein, TolC family (Enterobacter asburiae PDN3)
MTILRKPMLRRFTAALAFISLAINTAFANSNQVGIAPVATTTLKESILFAIDRDPSISQQ
AAQLGIGQAQIDEARSGWMPQISLNGSTGHSQTTDSSGSLKNSAAWGLSLTQLLYDFGKT
NNSISQSSAQRDSYRYQLMGTLSDVAEKTALSYVEVKRYSDLLQAAIENVQALKNVEQLA
KLRADAGVSSTSDELQTRTRIAGMQATVAQYTAALNSARARLAVLTGMQAEAYSPVPANL
AVEPDSLNRIDYSLIPAVMAAQNMERSAQYGVETAKSQHWPTLSLKGGRTRYESDNRSYW
DDQIQLNIDAPLYQGGAVSARVRQAEGARAMASSQVDQARFDVLQKASVAQADWTGARGR
MEAGKQQLENALRARDVYKNEYTLSKRSINDLLSVEQDVWQATSAKIIAEYDGWSSAINY
ASAVDNLMPLIGIEKNAAAKLPDLS