Protein Info for EX28DRAFT_1344 in Enterobacter asburiae PDN3

Annotation: type I secretion system ATPase, LssB family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 726 transmembrane" amino acids 161 to 182 (22 residues), see Phobius details amino acids 194 to 213 (20 residues), see Phobius details amino acids 267 to 290 (24 residues), see Phobius details amino acids 296 to 314 (19 residues), see Phobius details amino acids 387 to 406 (20 residues), see Phobius details amino acids 410 to 419 (10 residues), see Phobius details TIGR03375: type I secretion system ATPase" amino acids 8 to 700 (693 residues), 831 bits, see alignment E=3.8e-254 PF00664: ABC_membrane" amino acids 162 to 421 (260 residues), 107.8 bits, see alignment E=1.2e-34 PF00005: ABC_tran" amino acids 493 to 640 (148 residues), 107.8 bits, see alignment E=1e-34

Best Hits

KEGG orthology group: K06148, ATP-binding cassette, subfamily C, bacterial (inferred from 96% identity to enc:ECL_02074)

Predicted SEED Role

"Type I secretion system ATPase, LssB family LapB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (726 amino acids)

>EX28DRAFT_1344 type I secretion system ATPase, LssB family (Enterobacter asburiae PDN3)
MKTHPQYEPWLQGMLIIAKHYRLDFSAEHVRVTINHESQSPRQLVLEEMARQLGLGMRMV
AAESVSLDPWRLPLLAEFTGGQIAVINRMDSEGNVSLQFSGDGGLETTLTRDELGARLKG
LMVLRPLESTPDARVDDYIKPYEKNWFWQLALKDWRRYSDIMLVALVANVLALSGMVFSM
QVYDRVVPSQSEATLWVLFGGVMIAIVFEFIMRMLRVHISDVLGKRADLRISERVFAHAL
RIKNGARSKSTGSFIAQIRELESVRELITSTTIAAISDLPFFLLFVFILWMIGGPLVLVV
LLAVPLLLIPGLLVQRPLGKLSSEGMRESAIRNATLVEAVQGIEDIKLMRAEQRFQNQWN
NTNDVAASVGMKQRWLTGLLLTWTQEVQSIVYAVVLLVGCYLVISGDMTTGALVGTSILA
SRTIAPLSQISGVLSRWQSAKVARKGLDDLMQRPIDDPQHGKKVHKAHLRGDYALEDVGF
YYDEEEKLTVLNISKLQIRAGERVAVLGRNGSGKSTLLQLLAGMQEPQQGSILLDDIALN
HLDPADVRRDMQLLSQQARLFFGSVRDNILMGNPLATDDEIHQALVNSGALEFVRKQKMG
LNYIINEGGAGLSGGQRQALLLARALITSPNILLLDEPTAWLDEMSEKQFIQHLHKWLGK
RRTLVVATHRLPILDLVDRIIVLENGKVVMDGPRDAILHQHGMAPQKAAQRTVTMKPAAV
AEEGAA