Protein Info for EX28DRAFT_1267 in Enterobacter asburiae PDN3

Annotation: Predicted acyltransferases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 transmembrane" amino acids 10 to 29 (20 residues), see Phobius details amino acids 38 to 61 (24 residues), see Phobius details amino acids 82 to 100 (19 residues), see Phobius details amino acids 140 to 164 (25 residues), see Phobius details amino acids 171 to 189 (19 residues), see Phobius details amino acids 195 to 214 (20 residues), see Phobius details amino acids 226 to 249 (24 residues), see Phobius details amino acids 255 to 276 (22 residues), see Phobius details amino acids 289 to 308 (20 residues), see Phobius details amino acids 319 to 340 (22 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 4 to 337 (334 residues), 95.9 bits, see alignment E=1.3e-31

Best Hits

Predicted SEED Role

"Exopolysaccharide production protein ExoZ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (357 amino acids)

>EX28DRAFT_1267 Predicted acyltransferases (Enterobacter asburiae PDN3)
MMIANIQYLRFLAAFLVIYAHANLAVYGITPQITNLGGVGVDIFFIISGFIMPYIIYGGL
YKDGMTPKLTPLGFIKRRITRIWPLYLVATLVVVFISWLVDSGAISQPTADFAYIFNGSR
LDLMWIIKTMTFMNFDKPPILGIGWTLQFEFLFYFLLAGLLAIGIKKANSLEFYSVCALV
VFGAGNALAHGESKVLVTLSSQMFIEFILGMYLYRMYSAGCILPKWLAWIGIASFFPLFA
FANSGVFAYNDYSRLLTWGIPAFVIVWSALSLEGVIPHNRTFLLLGDSSYSLYLSHGISA
PVFLFIWTQLDLDKTVSVVPYVIVYYIYCQVIALACYKLIEKPVNGWIKKKAYGKAK