Protein Info for EX28DRAFT_1264 in Enterobacter asburiae PDN3

Annotation: Predicted acyltransferases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 transmembrane" amino acids 9 to 30 (22 residues), see Phobius details amino acids 36 to 56 (21 residues), see Phobius details amino acids 77 to 96 (20 residues), see Phobius details amino acids 126 to 146 (21 residues), see Phobius details amino acids 158 to 177 (20 residues), see Phobius details amino acids 190 to 214 (25 residues), see Phobius details amino acids 226 to 246 (21 residues), see Phobius details amino acids 258 to 278 (21 residues), see Phobius details amino acids 289 to 308 (20 residues), see Phobius details amino acids 328 to 346 (19 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 14 to 343 (330 residues), 97.6 bits, see alignment E=3.8e-32

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (362 amino acids)

>EX28DRAFT_1264 Predicted acyltransferases (Enterobacter asburiae PDN3)
METLKNKEILPLTSLRFFAAAIVVIAHLGYDYHLGGMGVTFFFILSGFILSYNYAIKFMD
WSSKQLISMWISRVSRIYPVHIFMFILSLPLSYIYAREYSVIDTLSNIILLQSWYPNGQG
TFSYNGVSWTLSCELFFYLTLPFVLFTCSRRALQTKTALIFVAMLLIMAAIWLASLSAGH
DIVEYSFKWWFYVISPYLRWMDFLFGIALGYAFLKVKSVKPKKINIFSLLEVLSLFSVVG
FYFYFLHEELPFKWNYSAYFNPLFGAIIYIFSFQSGLLSKFLSMQAFTYLGRISFSIYMT
HQVLMFYWNRYIVNLNYIASTKEEALNQLIYCAAVLIMSVFTYHAIENPARRAIHKLSST
PG