Protein Info for EX28DRAFT_1253 in Enterobacter asburiae PDN3

Annotation: Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 PF23441: SDR" amino acids 46 to 237 (192 residues), 31.8 bits, see alignment E=2.1e-11 PF00106: adh_short" amino acids 50 to 238 (189 residues), 170.9 bits, see alignment E=4.6e-54 PF08659: KR" amino acids 53 to 215 (163 residues), 42.4 bits, see alignment E=1.5e-14 PF13561: adh_short_C2" amino acids 58 to 290 (233 residues), 197.6 bits, see alignment E=4.8e-62

Best Hits

Swiss-Prot: 60% identical to YHXD_BACSU: Uncharacterized oxidoreductase YhxD (yhxD) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 96% identity to enc:ECL_02055)

MetaCyc: 55% identical to NADP+-dependent aldehyde reductase (Escherichia coli K-12 substr. MG1655)
1.1.1.-

Predicted SEED Role

"Oxidoreductase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (294 amino acids)

>EX28DRAFT_1253 Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) (Enterobacter asburiae PDN3)
MSDTKQRTNAYPQPPFPEQPQTPPGLASEMQPVPDHGEKSYKGHGRLAGKKALITGGDSG
IGRAVAIAYAREGADVAINYLPEEEKDASEVIDLIEAEGRKAVALPGDVRDETFCQNLVE
EAVSKLGGLDILVNNAGRQQFRESLEELTTEDFDATFKTNVYAPFWITKAALRHLKASSV
IINTSSVQAVKPSPVLLDYAQTKACLAVFTKSLAKQLGPKGIRVNAVAPGPYWTVLQSSG
GQPMEKVKEFGGDTPLGRPGQPVEIAPLYVTLASDECSFTSGQVWCSDGGDGVI