Protein Info for EX28DRAFT_1249 in Enterobacter asburiae PDN3

Annotation: amidohydrolase, PncC family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02464: CinA
  • amino acids 14 to 165 (152 residues), 157 bits, E=1.5e-50
• TIGR00199: amidohydrolase, PncC family
  • amino acids 19 to 165 (147 residues), 155.4 bits, E=5.9e-50

Best Hits

Swiss-Prot: 54% identical to YDEJ_ECOLI: Protein YdeJ (ydeJ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 87% identity to enc:ECL_02051)

MetaCyc: 41% identical to NMN aminohydrolase (Escherichia coli K-12 substr. MG1655)
Nicotinamide-nucleotide amidase. [EC: 3.5.1.42]

Predicted SEED Role

"C-terminal domain of CinA paralog, YdeJ"

MetaCyc Pathways

• NAD salvage pathway II (PNC IV cycle) (4/5 steps found)

KEGG Metabolic Maps

• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.42

Protein Sequence (172 amino acids)

>EX28DRAFT_1249 amidohydrolase, PncC family (Enterobacter asburiae PDN3)
MSNLFHDSNNTVGELTKKLASKLTDLGLRLTTAESCTGGKLSVALCAEENTAEFYDVGLV
VFSDEAKMRILGVRPETLERFTAVSEQTVTEMAASIRDIAQADISIAISGYAGPEGGDDG
TAAGTVCFAWNIRGETKTRTVLFSGDCQDVVEKAVHYSLAELVTTLSDGNNG