Protein Info for EX28DRAFT_1248 in Enterobacter asburiae PDN3

Annotation: Short-chain dehydrogenases of various substrate specificities

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 transmembrane" amino acids 305 to 324 (20 residues), see Phobius details PF08659: KR" amino acids 3 to 167 (165 residues), 54.5 bits, see alignment E=2.2e-18 PF00106: adh_short" amino acids 3 to 189 (187 residues), 145.4 bits, see alignment E=2.4e-46 PF13561: adh_short_C2" amino acids 11 to 176 (166 residues), 95.2 bits, see alignment E=7.1e-31

Best Hits

KEGG orthology group: None (inferred from 93% identity to enc:ECL_02050)

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (326 amino acids)

>EX28DRAFT_1248 Short-chain dehydrogenases of various substrate specificities (Enterobacter asburiae PDN3)
MAVIVITGGTAGVGKATALHFAKAGYDVGLIARDEASLDSTQEELRRFGVNAHAVQADVA
DSQAVVDAANEIEYRLGAIDVWVNNAMGAVLAPFRTLTPDEFRRVTDVTYLGYVNGTRAA
LELMVPRDRGVIIQVGSALAYRSIPLQSAYCGAKAAIRGFTDAVRTELMHENSRVQLSMV
QMPGLNTPQFEWARNKFAWAMRPVPPVFEPEVAASAIFRVAQKPVRELWVGSSTIQSIVG
QFFFPGFLDRLMVKKAWEGQMTDALNAPDRRDYLDQPVNDLHKIHGRFTDEAKTRAPSVT
SGMPGKVALGALAVAGIVLTRLITRR