Protein Info for EX28DRAFT_1246 in Enterobacter asburiae PDN3

Annotation: cytochrome d oxidase, subunit II (cydB)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 transmembrane" amino acids 6 to 37 (32 residues), see Phobius details amino acids 60 to 80 (21 residues), see Phobius details amino acids 82 to 102 (21 residues), see Phobius details amino acids 117 to 138 (22 residues), see Phobius details amino acids 158 to 179 (22 residues), see Phobius details amino acids 198 to 217 (20 residues), see Phobius details amino acids 230 to 249 (20 residues), see Phobius details amino acids 261 to 281 (21 residues), see Phobius details amino acids 301 to 323 (23 residues), see Phobius details TIGR00203: cytochrome d ubiquinol oxidase, subunit II" amino acids 6 to 214 (209 residues), 144.4 bits, see alignment E=2.7e-46 PF02322: Cyt_bd_oxida_II" amino acids 6 to 325 (320 residues), 330.4 bits, see alignment E=5.6e-103

Best Hits

KEGG orthology group: K00426, cytochrome bd-I oxidase subunit II [EC: 1.10.3.-] (inferred from 95% identity to enc:ECL_02048)

MetaCyc: 65% identical to cyanide insensitive ubiquinol oxidase subunit II (Pseudomonas putida KT2440)
RXN-6883 [EC: 1.10.3.11]

Predicted SEED Role

"putative Cytochrome bd2, subunit II" in subsystem Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 1.10.3.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (336 amino acids)

>EX28DRAFT_1246 cytochrome d oxidase, subunit II (cydB) (Enterobacter asburiae PDN3)
MGVDISVIWFAIIVFATLMYIIMDGFDLGIGLLFNFVGDAKERDVMVNSVAPVWDGNETW
LVLGGAGLFGAFPLAYAVIVDALTIPLTAMLIGLIFRGVAFEFRFKATPSHRKFWDYSFA
GGSLLATFSQGIVVGAMINGFDVEGRRFVGSALDWLTPFNLFCGIGLVVAYTLLGTTWLI
MKSEGALQARMRELTRHVLLALMVVIAVVSIWTPLGWQYVADRWFTLPNFFWFLPVPLLV
GLFSVLIWRLTRNPASHSRPFLLTLGLIFLGFSGLGISLWPNIIPPRITLWEAAAPPASQ
LFMLVGTLLIIPVILVYTAWSYYVFRGKVSDTEGYH