Protein Info for EX28DRAFT_1226 in Enterobacter asburiae PDN3

Annotation: EamA-like transporter family/Multidrug resistance efflux transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 transmembrane" amino acids 5 to 23 (19 residues), see Phobius details amino acids 33 to 51 (19 residues), see Phobius details amino acids 63 to 84 (22 residues), see Phobius details amino acids 91 to 112 (22 residues), see Phobius details amino acids 118 to 135 (18 residues), see Phobius details amino acids 141 to 162 (22 residues), see Phobius details amino acids 182 to 200 (19 residues), see Phobius details amino acids 212 to 234 (23 residues), see Phobius details amino acids 243 to 261 (19 residues), see Phobius details amino acids 267 to 286 (20 residues), see Phobius details PF00892: EamA" amino acids 8 to 134 (127 residues), 40.7 bits, see alignment E=1.4e-14 amino acids 166 to 285 (120 residues), 53.9 bits, see alignment E=1.1e-18

Best Hits

KEGG orthology group: None (inferred from 93% identity to enc:ECL_02027)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (298 amino acids)

>EX28DRAFT_1226 EamA-like transporter family/Multidrug resistance efflux transporter (Enterobacter asburiae PDN3)
MNALLYGLVVVIWGTTWIAIFLQQGSVAAPVSIFWRFAVASLTMMVVLIALRRLRKLALR
DHLFCMLQGCCVFCFNFWCFYAAASHINTGLESVIFSMAVLYNAINSFIFFGQRPPARFW
TAAALGLTGIVTLFWDDLLASGWSASLLTGIGLSALGTYGFSLGNMISMRHQRRGLETMT
TNAWAMLYGTLVMGCIALFRGDSFAPEWTISYIGALLYLALFGSVIAFGAYFTLVGRIGP
GKAAYSTLLFPLVALSISTVYEGYVWHVNGIVGLLLILGGNMVMFTKPETWFRRLRMA