Protein Info for EX28DRAFT_1224 in Enterobacter asburiae PDN3

Annotation: benzoate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 signal peptide" amino acids 1 to 11 (11 residues), see Phobius details amino acids 32 to 35 (4 residues), see Phobius details transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 43 to 65 (23 residues), see Phobius details amino acids 70 to 88 (19 residues), see Phobius details amino acids 94 to 114 (21 residues), see Phobius details amino acids 120 to 138 (19 residues), see Phobius details amino acids 144 to 161 (18 residues), see Phobius details amino acids 168 to 185 (18 residues), see Phobius details amino acids 205 to 224 (20 residues), see Phobius details amino acids 244 to 274 (31 residues), see Phobius details amino acids 288 to 312 (25 residues), see Phobius details amino acids 319 to 340 (22 residues), see Phobius details amino acids 352 to 382 (31 residues), see Phobius details TIGR00843: benzoate transporter" amino acids 8 to 381 (374 residues), 528.6 bits, see alignment E=4.8e-163 PF03594: BenE" amino acids 10 to 381 (372 residues), 488.9 bits, see alignment E=5e-151

Best Hits

Swiss-Prot: 68% identical to YDCO_ECOLI: Inner membrane protein YdcO (ydcO) from Escherichia coli (strain K12)

KEGG orthology group: K05782, benzoate membrane transport protein (inferred from 86% identity to enc:ECL_02025)

Predicted SEED Role

"Benzoate transport protein" in subsystem Benzoate degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (388 amino acids)

>EX28DRAFT_1224 benzoate transporter (Enterobacter asburiae PDN3)
MRPSSHLVPVALAGFVAVLVGYASSAAIIWQAAAAAGASAQQIAGWMTALGIGMGVSTLA
LSWWYKAPVLTAWSTPGAALLATSLHGVTLSETIGVFIFANALILLCGITGLFARLMRLI
PHSLAAAMLAGVLLQFGLHAFAHLEGHFLLCGSMIAAWLLAKALAPRYAIVVTLLVGGIV
AWAGGDVVTDKLAFSLVMPEFTAPTFTFTSLVSIGVPFFLVTMASQNAPGFATMKASGYP
LAVSPLIIVTGALALLFSPFGVFSICIAAITAAICQSPDAHPDAGKRWLAAIAAGGFYLL
AGIFGGSITGLMAALPLSWIQTLAGLALLGTISGSLYQALSHEAERDAAIVTFLMTASGV
TILGIGSAFWGLVLGGVCYALFSRARRT