Protein Info for EX28DRAFT_1218 in Enterobacter asburiae PDN3

Annotation: Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 119 to 137 (19 residues), see Phobius details PF01965: DJ-1_PfpI" amino acids 23 to 190 (168 residues), 62.8 bits, see alignment E=5.6e-21 PF12833: HTH_18" amino acids 252 to 331 (80 residues), 81.7 bits, see alignment E=5.7e-27

Best Hits

KEGG orthology group: K13633, AraC family transcriptional regulator, transcriptional activator FtrA (inferred from 90% identity to enc:ECL_02020)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (339 amino acids)

>EX28DRAFT_1218 Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain (Enterobacter asburiae PDN3)
MRSLMPENSKKMTNLRQIARPQVVVLAYDGLCTFEFGVAVEIFGLPRPELGDEWYRFAVA
SVDSGELRATGGIRIVTDGDLSLLASADLIVVPGWRGLDSPVPDELCEALRQASARGCQL
LSICSGVFVLAATGLLNGRKATTHWRYIDALKARYPDIVVVEDVLYQDEGDILTSAGSAA
GIDLCLHVVRRDFGMETANSVARRLVIPPHRDGSQPQQLSRPVAQLRESQRLGQLFDFLH
THLIEAHSVDSLARRVGMSQRTFLRRFEAATGTTPARWLINERLLRAKDYLESSRLSIDS
IAEQTGFGQASTLRHHFRQQFALSPAQYRKQFSRPGTAR