Protein Info for EX28DRAFT_1193 in Enterobacter asburiae PDN3

Annotation: diguanylate cyclase (GGDEF) domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 PF01590: GAF" amino acids 30 to 154 (125 residues), 55.4 bits, see alignment E=1.5e-18 PF13185: GAF_2" amino acids 31 to 154 (124 residues), 34.4 bits, see alignment E=3.7e-12 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 163 to 318 (156 residues), 141.5 bits, see alignment E=1e-45 PF00990: GGDEF" amino acids 164 to 318 (155 residues), 130.2 bits, see alignment E=9.8e-42

Best Hits

KEGG orthology group: None (inferred from 92% identity to enc:ECL_01986)

Predicted SEED Role

"FOG: GGDEF domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (321 amino acids)

>EX28DRAFT_1193 diguanylate cyclase (GGDEF) domain (Enterobacter asburiae PDN3)
MKAPATPENETDRLNSLRESGLLDIDSSPAFDRLTRLAKRFFQVPLAMVNLIDEHSLIVK
SADGQAPGSVPRNISFCGHTILTEAPLVVGDMLQDDRFADNPLVAGEPRVRFYAGFPLRL
RDGASVGSLCLIDYAPREFSAADLAVLGDLGALAEDEFAAISAATTDELTGLFNRRGFNQ
LVRFTLSVARRRAEPLTLGWLDLDRFKEINDRFGHEEGDKALKAMAQLMRASFREADLLV
RFGGDEFAVLFADTDEQGAWIAMQYLAEQVESYNARKLHPWSLHFSWGLSEFDHNGNDLQ
QWLKEADEKMYAMKQQRQRAR