Protein Info for EX28DRAFT_1180 in Enterobacter asburiae PDN3

Annotation: DNA-binding HTH domain-containing proteins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 PF03472: Autoind_bind" amino acids 26 to 152 (127 residues), 57 bits, see alignment E=2.4e-19 PF00196: GerE" amino acids 168 to 220 (53 residues), 73.3 bits, see alignment E=1.5e-24 PF08281: Sigma70_r4_2" amino acids 168 to 210 (43 residues), 26.3 bits, see alignment 7e-10

Best Hits

Swiss-Prot: 42% identical to EXPR_DICD3: Transcriptional activator protein ExpR (expR) from Dickeya dadantii (strain 3937)

KEGG orthology group: None (inferred from 81% identity to pva:Pvag_pPag30141)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (230 amino acids)

>EX28DRAFT_1180 DNA-binding HTH domain-containing proteins (Enterobacter asburiae PDN3)
MKDTYYNDIAINTLIQSELDAFFEDFKGIVFAYAIMNKKDPSQMRIINNSPEWFDIYLDR
KYQFIDPVIIRALRCVEDFFWESDVILSDGYNLTRIFNESVQYDIYQGQTFPLHDYLNNL
VVLSVISPKHSGIDIEKYRPQFLSFLVQLHQKTLNLYSQHQQKKNVFLSPRERQILKWVS
AGKTYAEISVILSIAERTVKFHMGNVMKKLGVNNARHAIKLGTELRLLDD