Protein Info for EX28DRAFT_1171 in Enterobacter asburiae PDN3

Annotation: Helix-turn-helix domain/AraC-type transcriptional regulator N-terminus

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 166 PF06719: AraC_N" amino acids 2 to 43 (42 residues), 48.4 bits, see alignment E=1.2e-16 PF00165: HTH_AraC" amino acids 66 to 106 (41 residues), 26.7 bits, see alignment E=7.2e-10 PF12833: HTH_18" amino acids 79 to 153 (75 residues), 82 bits, see alignment E=4.7e-27

Best Hits

Predicted SEED Role

"FIG00639224: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (166 amino acids)

>EX28DRAFT_1171 Helix-turn-helix domain/AraC-type transcriptional regulator N-terminus (Enterobacter asburiae PDN3)
VTDVLLEPFCRLLSLLDEPQAIPVLGPLIQREIHYRLLMSDRSDHIRQIAAVDGHGYRIG
KAIVWLKTHIASPLRVEELASRVQMSTPSFHQHFRQLAGMSPLRYQKWLRLNEARRLMLN
EHYDVTTAAYAVGYESLSHFSREYSRMFGQSPKRDITVLRKSAGKL