Protein Info for EX28DRAFT_1168 in Enterobacter asburiae PDN3

Annotation: RND family efflux transporter, MFP subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF19335: HMBD" amino acids 47 to 74 (28 residues), 45.9 bits, see alignment (E = 1.1e-15) PF25919: BSH_CusB" amino acids 127 to 244 (118 residues), 89.8 bits, see alignment E=2e-29 PF25869: 3HB_CusB" amino acids 162 to 211 (50 residues), 57.7 bits, see alignment 2e-19 TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 208 to 395 (188 residues), 114.8 bits, see alignment E=2.1e-37 PF25954: Beta-barrel_RND_2" amino acids 248 to 325 (78 residues), 91.3 bits, see alignment E=9.4e-30 PF25967: RND-MFP_C" amino acids 330 to 387 (58 residues), 25.1 bits, see alignment E=3.4e-09

Best Hits

Swiss-Prot: 84% identical to SILB_SALTM: Putative membrane fusion protein SilB (silB) from Salmonella typhimurium

KEGG orthology group: None (inferred from 87% identity to enc:ECL_01962)

MetaCyc: 68% identical to copper/silver export system membrane fusion protein (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-90; TRANS-RXN0-280

Predicted SEED Role

"Cobalt/zinc/cadmium efflux RND transporter, membrane fusion protein, CzcB family" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (416 amino acids)

>EX28DRAFT_1168 RND family efflux transporter, MFP subunit (Enterobacter asburiae PDN3)
MASLKIKYAAMIVSSLIAGGLISVTAWQAIHSSEKTENSAPERKVLFWYDPMKPDVKFDK
PGKSPFMDMDLVPKYADENDSKSSAGIRIDPTQVQNLGLKTQKVTRGTLNYAQTIPANVS
YNDYQFVIVQARAEGFVEKVYPLTTGDKVKKGTPLIDITIPDWVEAQSEFLLLSGTGGTP
TQIKGVLERLRLAGMPDDDIQRLRATRTIQTRFTIRAPIDGAITAFDLRTGMNISKDKVV
AQIQGMDPVWIGAAVPESIAYLLKETSQFVISIPAWPDKSFPVEKWSLLPSADPTTRTLQ
VRLQVANKDELLKPGMNAYLKLNTQSQEMLLIPSQAVIDTGKEQRVITVDADGNFVPKRI
HVLHESQQQSGIGSGLEEGESVVVSGLFLIDSEANITGALERMRHAEAADGAHSGH