Protein Info for EX28DRAFT_1166 in Enterobacter asburiae PDN3

Annotation: efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR01845: efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family" amino acids 12 to 458 (447 residues), 347.9 bits, see alignment E=4.7e-108 PF02321: OEP" amino acids 67 to 249 (183 residues), 152.8 bits, see alignment E=4.4e-49 amino acids 274 to 457 (184 residues), 167 bits, see alignment E=2e-53

Best Hits

Swiss-Prot: 87% identical to SILC_SALTM: Probable outer membrane lipoprotein SilC (silC) from Salmonella typhimurium

KEGG orthology group: None (inferred from 93% identity to enc:ECL_01960)

MetaCyc: 72% identical to copper/silver export system outer membrane channel (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-90; TRANS-RXN0-280

Predicted SEED Role

"Cation efflux system protein CusC precursor" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (461 amino acids)

>EX28DRAFT_1166 efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family (Enterobacter asburiae PDN3)
MFLLKRLSISTVFILAGCVSLAPEYQRPEAPVPRQFSLSRNGLTPAAAGYQDTGWRNFFV
DPQVAGLITEALKNNRDIKMAALKVEEARAQFNVTDADRYPQLNASSGITYSGGLKSDKP
TAQQYDAGLALSYELDFFGKLKNMSDADRQNYFASEEARRAVHIMLVSNVSQSYFNQQLA
YKQLRIARDTLNNYRQSYAFVEQQLVTGSTNVLALEQARGQIESTRADIAKREGELAQAN
NALQLVLGTYSALPGDGGMNASDVAPVKLPPHLSSAILLQRPDIMEAEYQLKAADANIGA
ARAAFFPSISLTSGLSTGSTELSSLFTSGSGMWNFIPKIEIPIFNAGRNKANLKLAEIRQ
QQSVVNYEQKIQSAFKQVADALALRDSINQQLAAQQRYLDSLRITQQRARGLYSSGAVSY
IEVLDAERSLFSTQQNILDLIYARQVNEINLFTALGGGWVE