Protein Info for EX28DRAFT_1162 in Enterobacter asburiae PDN3

Annotation: Major Facilitator Superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 471 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 57 to 80 (24 residues), see Phobius details amino acids 87 to 106 (20 residues), see Phobius details amino acids 112 to 133 (22 residues), see Phobius details amino acids 145 to 167 (23 residues), see Phobius details amino acids 174 to 194 (21 residues), see Phobius details amino acids 206 to 225 (20 residues), see Phobius details amino acids 240 to 257 (18 residues), see Phobius details amino acids 277 to 300 (24 residues), see Phobius details amino acids 306 to 326 (21 residues), see Phobius details amino acids 338 to 359 (22 residues), see Phobius details amino acids 365 to 382 (18 residues), see Phobius details amino acids 404 to 428 (25 residues), see Phobius details amino acids 441 to 460 (20 residues), see Phobius details PF07690: MFS_1" amino acids 27 to 418 (392 residues), 147.2 bits, see alignment E=6.3e-47 PF00083: Sugar_tr" amino acids 30 to 191 (162 residues), 30.5 bits, see alignment E=1.8e-11

Best Hits

KEGG orthology group: K08169, MFS transporter, DHA2 family, multidrug resistance protein (inferred from 86% identity to enc:ECL_01956)

Predicted SEED Role

"FIG00731681: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (471 amino acids)

>EX28DRAFT_1162 Major Facilitator Superfamily (Enterobacter asburiae PDN3)
MTLFSNLPGDEGLPGHERARVMAAVMTTTLMGVFDGTMINIALPSMAKSMQVPANVAVWF
ANGYLLSAAMTLALFAALAARVGYRPVFLAGLATFTLTSIGCALAPTPEMLIGMRILQGI
GGAATLSIAPAILRSVFPGRLLGRILGLHALLIASSTAIAPVLGGTILDALSWQWLFAIN
IIPGSVALLLAWRALPRESAVDRSPFDAPGAVLSAALLGSAIMLADSLQRVTQHISQETL
GWGILTLTSALAFIWRIRRAQSPILPPVMFKNGRFTLAALTSLASFVSQGITFVALPFLF
QSVYGYSPVVSALLFTPWPIGIVLIAPHAGRWADTISAPLISTVGLMIFVGGLVLLATLP
DSPSAWNICLRSLVCGIGFGCFQSPNNREMLSNVAREYASYASGVLSIVRTFGQCLGAAA
VGVLLAATAGADHQSLDDRAVHLALWIAVIASTGSVLFSVSRLRPAVRASA