Protein Info for EX28DRAFT_1160 in Enterobacter asburiae PDN3

Annotation: Predicted membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 38 to 56 (19 residues), see Phobius details amino acids 62 to 84 (23 residues), see Phobius details amino acids 105 to 128 (24 residues), see Phobius details amino acids 141 to 160 (20 residues), see Phobius details amino acids 180 to 199 (20 residues), see Phobius details amino acids 219 to 255 (37 residues), see Phobius details amino acids 266 to 292 (27 residues), see Phobius details amino acids 306 to 327 (22 residues), see Phobius details PF06166: DUF979" amino acids 9 to 327 (319 residues), 404.6 bits, see alignment E=1.4e-125

Best Hits

KEGG orthology group: None (inferred from 95% identity to enc:ECL_01954)

Predicted SEED Role

"FIG001614: Membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (328 amino acids)

>EX28DRAFT_1160 Predicted membrane protein (Enterobacter asburiae PDN3)
MMTLITINRVYYLIGFVVMLLVVMTLRDRANPKRFTTALFWFLFGGIFLFGDLMVQELGK
SLAYRIIGGGVIAIALLAGFGLVGKGHYKMSTEDERLASSNRLKNWLFLPALMIPVVTVI
GTLFLKGVSVGGVFLLDQKQLTLAALCVACVAAILTGWWLTKGTPLHAIRQSRRLVDTIG
WAVILPQMLAMLGGVFVAANTGDSVQKVVSLFVNPDNRFMLVVIYCVGMALFTMIMGNAF
AAFPVLSAGIALPFLINVHHGNPAPLLAIGMYAGYCGTLMTPMAANFNIVPAALLELKDK
YQVIKIQIPTALTLLVVNVFLMYFLVFR