Protein Info for EX28DRAFT_1148 in Enterobacter asburiae PDN3

Annotation: Anti-sigma regulatory factor (Ser/Thr protein kinase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 141 PF13581: HATPase_c_2" amino acids 9 to 136 (128 residues), 64.7 bits, see alignment E=4.4e-22

Best Hits

KEGG orthology group: None (inferred from 59% identity to kva:Kvar_2980)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (141 amino acids)

>EX28DRAFT_1148 Anti-sigma regulatory factor (Ser/Thr protein kinase) (Enterobacter asburiae PDN3)
MLTPEHAAFPAELGSLTPLAGWLGERLSALAVDDEWRFALDLAVCEAATNIIRHALHEDA
SRAFSVQFDIRNHNVCVVFTDAGDAFPLERLEAARRDRFCEISPLLESGRGLMLILLSVD
RFSVERKADKNIATLEKKISV