Protein Info for EX28DRAFT_1112 in Enterobacter asburiae PDN3

Annotation: oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 PF00005: ABC_tran" amino acids 32 to 171 (140 residues), 102.9 bits, see alignment E=4.5e-33 PF13401: AAA_22" amino acids 47 to 199 (153 residues), 27 bits, see alignment E=9.6e-10 TIGR01727: oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain" amino acids 220 to 305 (86 residues), 74.5 bits, see alignment E=2.8e-25 PF08352: oligo_HPY" amino acids 222 to 287 (66 residues), 70.3 bits, see alignment E=3e-23

Best Hits

Swiss-Prot: 77% identical to DDPF_ECOLI: Probable D,D-dipeptide transport ATP-binding protein DdpF (ddpF) from Escherichia coli (strain K12)

KEGG orthology group: K02032, peptide/nickel transport system ATP-binding protein (inferred from 92% identity to enc:ECL_01918)

Predicted SEED Role

"Dipeptide transport ATP-binding protein DppF (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (309 amino acids)

>EX28DRAFT_1112 oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain (Enterobacter asburiae PDN3)
MSDVLLELDSVHVNFAARKNWLGRVTEQVHALNGLDLQIRRGETLGIVGESGCGKSTLAQ
LLMGMLKPSTGACQRAHHAGGMQMVFQDPLSSLDPRLPVWRIITEPVWVQKRSSERERRQ
LAEELALQVGIRPEYLDRLPHAFSGGQRQRIAIARALSSDPDIIVLDEPTSALDISVQAQ
ILNLLVTLQQQRNLTYVLISHNVLVVRHMSDRVAVMYLGQIVELGSAAQVLSEPRHPYTR
LLLDSVPRTGEPLDENLALRKTELPGNRHLPEGCFFRDRCPMAAQGCERPQPLQPSREGR
NVRCWRSLD