Protein Info for EX28DRAFT_1095 in Enterobacter asburiae PDN3

Annotation: ATPase components of various ABC-type transport systems, contain duplicated ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 535 PF00005: ABC_tran" amino acids 23 to 182 (160 residues), 106.6 bits, see alignment E=9.2e-34 amino acids 297 to 449 (153 residues), 114.7 bits, see alignment E=2.8e-36 PF13304: AAA_21" amino acids 114 to 216 (103 residues), 34.9 bits, see alignment E=1e-11 PF08352: oligo_HPY" amino acids 234 to 255 (22 residues), 14.6 bits, see alignment (E = 1.9e-05) amino acids 500 to 532 (33 residues), 18.3 bits, see alignment (E = 1.4e-06)

Best Hits

KEGG orthology group: None (inferred from 80% identity to eae:EAE_19780)

Predicted SEED Role

"ABC transporter ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (535 amino acids)

>EX28DRAFT_1095 ATPase components of various ABC-type transport systems, contain duplicated ATPase (Enterobacter asburiae PDN3)
MTVLSVENLTISYRTARQWREVVHNVSFTLGRGEMLAFVGESGSGKTTTAQAIIGLLADN
ARRDAGKISLNGEEISRWSAKRLDTLRGARISLVPQDPGNSLNPVKTIGVQVGEIIQLHQ
KVTRAQRDEQVLALLTKVGLSHPEQRMTQYPHQLSGGMKQRVLIAIAIALRPDVIVADEP
TSALDVTVQKRILDLLDILRRESGTAVLFVTHDLALAAQRADRLLVFRDGEVQEQGNTAD
IVRTPQHAYTRQLLSDLQGQRLTIAPVAGRPLASPAIRARAISKQFSLGKGHQLQALDRV
TFDVRRGSTHALVGESGSGKTTLARILLGFEQADSGQVIIDDIDATALSREARRQLRQKI
QFVYQNPFASLDPRQTLFDIIEEPLKNFSRLGKTERKLRVETVAQRVALPVELLTRTARE
LSGGQRQRVAIARALILEPTILVLDEATSALDVTVQAQILALLQQLQQQLGLTYLFITHD
LSTVRRIAHSVTVLRSGQVVEQGDVGTLFASPQNDYTRELIDAIPHFSPATEEFA