Protein Info for EX28DRAFT_1093 in Enterobacter asburiae PDN3

Annotation: uncharacterized peroxidase-related enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 TIGR04030: alkylhydroperoxidase domain protein, Avi_7169 family" amino acids 174 to 360 (187 residues), 290.9 bits, see alignment E=9.9e-91 TIGR01926: uncharacterized peroxidase-related enzyme" amino acids 204 to 360 (157 residues), 132.5 bits, see alignment E=2.9e-42 PF02627: CMD" amino acids 226 to 288 (63 residues), 43.4 bits, see alignment E=1.4e-15 TIGR00778: alkylhydroperoxidase AhpD family core domain" amino acids 241 to 288 (48 residues), 42.5 bits, see alignment 7.2e-15

Best Hits

KEGG orthology group: None (inferred from 78% identity to kpe:KPK_2497)

Predicted SEED Role

"Alkylhydroperoxidase AhpD domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (363 amino acids)

>EX28DRAFT_1093 uncharacterized peroxidase-related enzyme (Enterobacter asburiae PDN3)
MSLSQDILAELAEIKPGSPLAEARATRDAATRHAQGSYEILFSQQDADFALDERFAVAAK
VARWHSAEALAAHYAGFGLADPTSERLTPALNFARLLTFSPVEATPAALKALTQAGWSKE
GIVTLAQLVAFVSFQSRLITGLRLLNDKPVAKSDAPVAAGIWHTTATTVTGKAAPVAFTQ
QELGWEPWIAAKPLADFRDDEVAILAKFGHTDSDYFRLLGRNLPVLEQRTLTDKGIFYTS
GGLPRAERELAATVASKINGCIYCASVHARKASQLSKDDAAVEALLAVRPGRSLSEGQSA
RWQAEIDFAAALSVTPPAATPLHLAALEKEGLDTLAQLDLVQSAAFFAWANRLMLTLGEP
WLA