Protein Info for EX28DRAFT_1092 in Enterobacter asburiae PDN3

Annotation: Arabinose efflux permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 44 to 62 (19 residues), see Phobius details amino acids 71 to 93 (23 residues), see Phobius details amino acids 99 to 117 (19 residues), see Phobius details amino acids 127 to 148 (22 residues), see Phobius details amino acids 158 to 178 (21 residues), see Phobius details amino acids 202 to 221 (20 residues), see Phobius details amino acids 235 to 255 (21 residues), see Phobius details amino acids 266 to 285 (20 residues), see Phobius details amino acids 291 to 314 (24 residues), see Phobius details amino acids 331 to 352 (22 residues), see Phobius details amino acids 358 to 378 (21 residues), see Phobius details PF07690: MFS_1" amino acids 8 to 329 (322 residues), 134.7 bits, see alignment E=3.9e-43 PF00083: Sugar_tr" amino acids 40 to 177 (138 residues), 39.8 bits, see alignment E=2.8e-14

Best Hits

Swiss-Prot: 72% identical to ARAJ_ECOLI: Putative transporter AraJ (araJ) from Escherichia coli (strain K12)

KEGG orthology group: K08156, MFS transporter, DHA1 family, arabinose polymer transporter (inferred from 93% identity to enc:ECL_01907)

Predicted SEED Role

"Protein AraJ precursor" in subsystem L-Arabinose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (391 amino acids)

>EX28DRAFT_1092 Arabinose efflux permease (Enterobacter asburiae PDN3)
MKKTIFSLALGTFGLGMAEFGIMGVLTELAHDTGISIPSAGNMISFYAFGVVIGAPIVAL
FSGKFSLKTTLLFLVAMSAVGNALFTFSTSYFWLAVGRLISGFPHGAIFGVGAIILSKIA
PPGRVTVAVAGMIAGMTVANLVGVPLGTWLGHQFSWRYTFFLIAVFDALVILSVLLWVPD
IRDTSEIKLTEQFHFLKKPEPWLIFAATMFGNAGVFAWFSFVKPFMVIVSGYSEGMMTAI
MMLMGLGMVLGNLLSGKLSGRFSPLRIAATTDMVIVASLLLLFAFGELKTASLVMGFICC
AGLFALSAPLQILLLQNAKGGEMLGAAGGQMAFNLGSAIGAYFGGMMIVLGFSWRYVTLP
AAILSFSAMSALLIYGHLRARRAQANARALA