Protein Info for EX28DRAFT_1081 in Enterobacter asburiae PDN3

Annotation: Outer membrane protein (porin)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF13609: Porin_4" amino acids 9 to 331 (323 residues), 73.5 bits, see alignment E=2.7e-24 PF00267: Porin_1" amino acids 27 to 360 (334 residues), 499.2 bits, see alignment E=7.3e-154

Best Hits

Swiss-Prot: 83% identical to OMPD_CITK8: Outer membrane porin protein OmpD (ompD) from Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

KEGG orthology group: None (inferred from 92% identity to enc:ECL_01898)

MetaCyc: 64% identical to outer membrane porin N (Escherichia coli K-12 substr. MG1655)
RXN0-2481

Predicted SEED Role

"Outer membrane porin protein NmpC precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (360 amino acids)

>EX28DRAFT_1081 Outer membrane protein (porin) (Enterobacter asburiae PDN3)
MKLKLVAVAVTSMLAAGVVNAAEIYNKDGNKLDLYGKVTGLHYFSDDTDNDGDKTYVRLG
FKGETQINDQLSGYGQWEYEFKGNRSESQGSDGSKTRLAFAGLKFNEFGSFDYGRNYGVA
YDIGAWTDVLPEFGGDTWTQTDGFMTGRTTGVATYRNTDFFGLVDGLNVAAQYQGKNDRN
DITEANGDGWGLSSTYEMDGFGVGATYAKSDRTDRQVAAGRVANTVNAGGENAEVWAAGL
KYDANNIYLATTYSETRNMTNFGSGYIANKAQNFEVVAQYQFDFGLRPSIAYLKSKGKDL
GSYGDQDLVEYVDVGASYYFNKNMSTYVDYKINLVDDNSFTKATGVATDNIVAVGLTYQF