Protein Info for EX28DRAFT_1072 in Enterobacter asburiae PDN3

Annotation: amidase, hydantoinase/carbamoylase family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 TIGR01879: amidase, hydantoinase/carbamoylase family" amino acids 7 to 402 (396 residues), 396 bits, see alignment E=9.5e-123 PF04389: Peptidase_M28" amino acids 64 to 174 (111 residues), 26.4 bits, see alignment E=8.3e-10 PF01546: Peptidase_M20" amino acids 78 to 401 (324 residues), 86.1 bits, see alignment E=4.9e-28 PF07687: M20_dimer" amino acids 209 to 308 (100 residues), 27.6 bits, see alignment E=3.6e-10

Best Hits

Swiss-Prot: 46% identical to HYUC_RHIML: N-carbamoyl-L-amino-acid hydrolase (hyuC) from Rhizobium meliloti

KEGG orthology group: K06016, N-carbamoyl-L-amino-acid hydrolase [EC: 3.5.1.87] (inferred from 78% identity to cko:CKO_02939)

MetaCyc: 46% identical to N-carbamoyl-L-amino-acid hydrolase subunit (Sinorhizobium meliloti CECT4114)
N-carbamoyl-L-amino-acid hydrolase. [EC: 3.5.1.87]

Predicted SEED Role

"Beta-ureidopropionase (EC 3.5.1.6)" in subsystem Hydantoin metabolism or L-2-amino-thiazoline-4-carboxylic acid-Lcysteine conversion or Pyrimidine utilization (EC 3.5.1.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.87

Use Curated BLAST to search for 3.5.1.6 or 3.5.1.87

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (408 amino acids)

>EX28DRAFT_1072 amidase, hydantoinase/carbamoylase family (Enterobacter asburiae PDN3)
MILVNAERLWSTLEMMAQIGGTPAGGVTRLALSEEDRIARNLLRDWALDAGFTCEVDSMG
NMFIRRAGKNPQLAPVMTGSHVDTQPLGGNYDGVYGVLAGLELLRTLNDYHVETERDVVL
VNWTNEEGARFAPAMLSSGVWTGQFSEAYAHARADNDGITVGEALESIGYRGEASARAFP
VHACYELHIEQGPILEDEVIDIGLVRAAMGQRWFTLTLDGFAAHAGTTPMHSRRDALTAF
AELALKVEEIGYRHAPDGRATIGMAKVTPNSRNVVPSRVECSVEFRHPMQQALEAMEAAL
HKVAESLSLRGVAAAVERIFDYAPIAFDAECLARTEKAAAALGYSSKPMVSGAGHDTCYV
SKIAPASMIFIPCVKGISHNEAERILPEWSDKGANVLLHSVLSAALER