Protein Info for EX28DRAFT_1063 in Enterobacter asburiae PDN3

Annotation: Na+/citrate symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 transmembrane" amino acids 28 to 48 (21 residues), see Phobius details amino acids 54 to 74 (21 residues), see Phobius details amino acids 80 to 101 (22 residues), see Phobius details amino acids 117 to 138 (22 residues), see Phobius details amino acids 145 to 168 (24 residues), see Phobius details amino acids 175 to 201 (27 residues), see Phobius details amino acids 211 to 232 (22 residues), see Phobius details amino acids 268 to 288 (21 residues), see Phobius details amino acids 294 to 312 (19 residues), see Phobius details amino acids 324 to 345 (22 residues), see Phobius details amino acids 353 to 376 (24 residues), see Phobius details amino acids 420 to 442 (23 residues), see Phobius details PF03390: 2HCT" amino acids 26 to 435 (410 residues), 501.8 bits, see alignment E=6.5e-155

Best Hits

Swiss-Prot: 60% identical to MAEN_BACSU: Na(+)-malate symporter (maeN) from Bacillus subtilis (strain 168)

KEGG orthology group: K11616, malate:Na+ symporter (inferred from 93% identity to enc:ECL_01883)

Predicted SEED Role

"Citrate-sodium symport"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (443 amino acids)

>EX28DRAFT_1063 Na+/citrate symporter (Enterobacter asburiae PDN3)
MKDNPVPTSELSTSRFAFGLNNTEVGTVPLMLFVGIAAIVATSAWAGLLPKNMIGGLAVI
MTLGFAFAKVGRQIPVLKDIGGPAILCLMVPSVLVYFGVFGKHTLDTVHLLMKEANLLYF
VIACLVVGSILGMNRVLLIQGMMRMFVPLVAGTCMAVLSGLIVGSLFGYTPYHTFFFIIV
PIIGGGIGEGILPLSLAYSAILGQTPDVYVAQLAPAAVVGNIFAIICAGSLARLGAKRPA
LSGNGMLTRSKDDASLFAGAQSTQQTDFHLMGGGLLMVCAFFIVGGLFEKLVHIPGPVLM
ILIAVLCKYFRVIPSSMEQGAHSCYKFVSAALVWPLMIGLGMLYVPLESVVSVFSVGYVV
VCGSVVIAMALSGYFIASRLNMYPVEAAIVTCCHSGLGGTGDVAILSASNRMSLMPFAQI
ATRIGGASTVIFATLLMGWIMAR