Protein Info for EX28DRAFT_1060 in Enterobacter asburiae PDN3

Annotation: lipid A biosynthesis lauroyl (or palmitoleoyl) acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 transmembrane" amino acids 17 to 40 (24 residues), see Phobius details amino acids 126 to 146 (21 residues), see Phobius details TIGR02207: lipid A biosynthesis lauroyl (or palmitoleoyl) acyltransferase" amino acids 5 to 307 (303 residues), 456.2 bits, see alignment E=2.7e-141 PF03279: Lip_A_acyltrans" amino acids 5 to 298 (294 residues), 350.2 bits, see alignment E=4.5e-109

Best Hits

KEGG orthology group: K02517, lipid A biosynthesis lauroyl acyltransferase [EC: 2.3.1.-] (inferred from 86% identity to enc:ECL_01881)

Predicted SEED Role

"Lipid A biosynthesis lauroyl acyltransferase (EC 2.3.1.-)" in subsystem KDO2-Lipid A biosynthesis (EC 2.3.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (333 amino acids)

>EX28DRAFT_1060 lipid A biosynthesis lauroyl (or palmitoleoyl) acyltransferase (Enterobacter asburiae PDN3)
MTKLPRFSLAFLHPRYWLSWAGIAALWLIMLLPYPLLFRIGHGLGRLAMRLLPRRVEIAR
RNLELCFPEMKKAERESLLQRNFESVGMGVIETGMAWFWPSWRVKKCFTVQGYEHMEKAR
AKGNGVVLVGMHFLTLELGARIFGMLNPGIGVYRPNNNALLDWLQTRGRLRSNKTMLDRH
DLKGMIRSLKQNEILWYAPDHDYGKTNSVFVPFFAVPDAATTAGSYMLVKSAKPAVIPFV
PRRRADGSGYELIILEDISEALQGGDKESVATQMNRAIEQAVRMAPEQYMWLHRRFKTRP
EGQPDRYARRKNVAPRADILSAADLSDRSGVQH